Out of stock
LL-37
Cathelicidin fragment · 37 amino acids
10 mg
≥99% purityThird-party lab tested · JanoshikOut of stock
$152per vial
Buy more, pay less per vial
$152 for 1 vial. Lyophilized powder · single vial
Independent lab report
Measured by an independent lab
Janoshik measured this compound. The report number is printed on it, so you can look it up with the lab yourself.
- LL-37
- 9.97 mg
- Purity
- 99.666%
Easy returns
Unopened vials within 30 days, full refund of the items. Terms
Real person replies by text
949-204-6655Kept frozen
Stored at −20 °C until the day it ships.
Before you order
- How fast will my order ship?
- Order by 4 PM Pacific on a business day (Monday to Friday) and it ships the same day once payment has cleared; later orders ship the next business day. Every parcel is tracked, and transit is typically two to five business days. Shipping is $7.95, and orders of $199 or more ship free.
- How do I pay?
- At checkout you choose Venmo (@NuuVive) or USDC on Solana. No account is needed for either, and the checkout shows exactly what to send.
- Can I return it?
- Yes. Unopened, sealed vials can be returned within 30 days of delivery for a full refund of the items, for any reason. If something arrives damaged, wrong or missing, tell us within 30 days and we replace it or refund it. The full terms are on our refunds page.
- Can I talk to a real person?
- Yes. Text 949-204-6655 and a real person replies, or email support@nuuvive.com.
Description
A 37 amino acid peptide, the C-terminal fragment of the human cathelicidin protein hCAP18. Supplied lyophilized.
Specification
- Sequence
- [LL-37, 37 aa]
- Sequence length
- 37 amino acids
- Molecular weight
- 4493.3 g/mol
- Molecular formula
- C205H340N60O53
- CAS
- 154947-66-7
- Form
- Lyophilized powder
- Catalog number
- NV-LL37-10
These are reference facts for the compound, not measured results. Measured figures are those printed on the supplier’s lab report below; the lab record says whether the lot currently shipping was tested by NuuVive.
Lab record
Loading the lab record.
LL-37: questions
- What is LL-37?
- LL-37 is a cathelicidin fragment, 37 amino acids, supplied as lyophilized powder at 10 mg per vial.
- What is the molecular weight and sequence of LL-37?
- LL-37 has a molecular weight of 4493.3 g/mol, the molecular formula C205H340N60O53 and CAS number 154947-66-7. Its sequence is [LL-37, 37 aa] The full specification is in the table on this page.
- What is the purity of LL-37?
- ≥99% purity (99.666%, Janoshik #215328), from the supplier's third-party lab report. The same report (Janoshik Analytical #215328) measured LL-37 9.97 mg in the vial tested.
- Is there a lab report for LL-37?
- Yes. The supplier's third-party lab report (Janoshik Analytical, report 215328) is linked on this page, and it can be opened on the laboratory's own site to check that it is genuine.
Reviews
No reviews yet. Be the first to review LL-37.
Be the first to review LL-37
Your review is published right away. Your email is never shown.
Collection
LL-37 is supplied for in vitro and laboratory research. It is part of our Recovery collection.
Continue your research
Quality standards
The target specification, and how a target differs from a result.
Reading a lab test
What a lab report establishes, and how to read one.
Storage & cold chain
Handling and temperature conditions from our facility to yours.
Sourcing transparency
Where the material comes from and what we verify.