NuuVive
Product photography for Sermorelin is not yet available.
Vitality

Out of stock

Sermorelin

GHRH(1-29) amide · 29 amino acids

10 mg

≥99% purityThird-party lab tested · Janoshik

Out of stock

Size

$88per vial

Out of stock

One email when it returns. Nothing else. Or follow restocks on Telegram.

Buy more, pay less per vial

$88 for 1 vial. Lyophilized powder · single vial

Janoshik lab report #99781 for SermorelinView full report

Independent lab report

Measured by an independent lab

Janoshik measured this compound. The report number is printed on it, so you can look it up with the lab yourself.

Sermorelin
10.56 mg
Purity
99.532%
≥99% purityJanoshik report #99781

  • Easy returns

    Unopened vials within 30 days, full refund of the items. Terms

  • Real person replies by text

    949-204-6655

  • Kept frozen

    Stored at −20 °C until the day it ships.

Before you order

How fast will my order ship?
Order by 4 PM Pacific on a business day (Monday to Friday) and it ships the same day once payment has cleared; later orders ship the next business day. Every parcel is tracked, and transit is typically two to five business days. Shipping is $7.95, and orders of $199 or more ship free.
How do I pay?
At checkout you choose Venmo (@NuuVive) or USDC on Solana. No account is needed for either, and the checkout shows exactly what to send.
Can I return it?
Yes. Unopened, sealed vials can be returned within 30 days of delivery for a full refund of the items, for any reason. If something arrives damaged, wrong or missing, tell us within 30 days and we replace it or refund it. The full terms are on our refunds page.
Can I talk to a real person?
Yes. Text 949-204-6655 and a real person replies, or email support@nuuvive.com.

Description

The amidated 1-29 fragment of human growth hormone-releasing hormone, without substitution. Supplied lyophilized, with an independent lab report on identity and purity.

Specification

Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Molecular weight
3357.9 g/mol
Molecular formula
C149H246N44O42S
CAS
86168-78-7
Form
Lyophilized powder
Catalog number
NV-SER-10

These are reference facts for the compound, not measured results. Measured figures are those printed on the supplier’s lab report below; the lab record says whether the lot currently shipping was tested by NuuVive.

Lab record

Loading the lab record.

Sermorelin: questions

What is Sermorelin?
Sermorelin is a ghrh(1-29) amide, 29 amino acids, supplied as lyophilized powder at 10 mg per vial.
What is the molecular weight and sequence of Sermorelin?
Sermorelin has a molecular weight of 3357.9 g/mol, the molecular formula C149H246N44O42S and CAS number 86168-78-7. Its sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. The full specification is in the table on this page.
What is the purity of Sermorelin?
≥99% purity (99.532%, Janoshik #99781), from the supplier's third-party lab report. The same report (Janoshik Analytical #99781) measured Sermorelin 10.56 mg in the vial tested.
What sizes is Sermorelin available in?
NuuVive lists Sermorelin in 3 sizes: 2 mg, 5 mg and 10 mg. Each size is its own vial with its own catalog number; choose the size on this page.
Is there a lab report for Sermorelin?
Yes. The supplier's third-party lab report (Janoshik Analytical, report 99781) is linked on this page, and it can be opened on the laboratory's own site to check that it is genuine.

Reviews

No reviews yet. Be the first to review Sermorelin.

Be the first to review Sermorelin

Your review is published right away. Your email is never shown.

Your rating

Shown as your first name and last initial.

Never shown.

Collection

Sermorelin is supplied for in vitro and laboratory research. It is part of our Vitality collection.

More in Vitality

Continue your research